PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.L03237.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family FAR1
Protein Properties Length: 146aa    MW: 16798.1 Da    PI: 7.8086
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.L03237.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR165.21.8e-2040123390
              FAR1   3 YneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90 
                       Y +YA   GF vr+++  ++ r+geit+rtfvC++ g++ +++++  +++ +r+e r+gC a++k k + +g +ev++ ++ HnH++ 
  Eucgr.L03237.1.p  40 YVAYAIGKGFGVRNDNLLRN-RKGEITRRTFVCNCAGHPINSSDQ--EKKYHRSEVRCGCPARIKFKVD-NGIYEVIEYVSTHNHPFI 123
                       99***************999.7788**************999877..89999****************9.***************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031015.5E-1840124IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 146 aa     Download sequence    Send to blast
MAESEYETSH LAHVMRDMEK DYEFAIGMVF SNELEAYHTY VAYAIGKGFG VRNDNLLRNR  60
KGEITRRTFV CNCAGHPINS SDQEKKYHRS EVRCGCPARI KFKVDNGIYE VIEYVSTHNH  120
PFIPEGQKHM IRCGRMMSDT CKCYS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010056981.15e-96PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
TrEMBLA0A059ANC45e-72A0A059ANC4_EUCGR; Uncharacterized protein
TrEMBLA0A059CXY96e-69A0A059CXY9_EUCGR; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM1499737
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G59470.21e-12FAR1 family protein